PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00817.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 343aa    MW: 37771.2 Da    PI: 6.4079
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00817.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-161461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg W++eEde+l++++  +G g+W+ ++ + g+ R++k+c++rw +yl
  Zmw_sc00817.1.g00060.1.am.mk 14 RGLWSPEEDEKLIRYISTHGYGCWSEVPDKAGLQRCGKSCRLRWINYL 61
                                  788*******************************************97 PP

2Myb_DNA-binding54.23.2e-1767111147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rgr+++eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  Zmw_sc00817.1.g00060.1.am.mk  67 RGRFSAEEEKLIISLHAIVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                                   89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.363961IPR017930Myb domain
SuperFamilySSF466891.05E-2911108IPR009057Homeodomain-like
SMARTSM007179.8E-131363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
CDDcd001673.15E-121761No hitNo description
PROSITE profilePS5129425.4962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-2565116IPR009057Homeodomain-like
SMARTSM007174.4E-1766114IPR001005SANT/Myb domain
PfamPF002498.0E-1667111IPR001005SANT/Myb domain
CDDcd001673.96E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIS THGYGCWSEV PDKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF SAEEEKLIIS LHAIVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPA  120
STTSSSSVSP PCSTVTAASD AAHGHLQTLP FSVADHQLDA MIINQGLALP SSTKLAVAGQ  180
DSPPTAPLPP QHCPFFMFDT SASPPSSLSP PTAAQLQHPF LTFTTAAVDV PSYQLPPLVD  240
GMSMNMSALD CSSLGDYERG HDHDGNNGQA APGMSSNGGC CGYEQQKQQH EQQQQQLGHD  300
QWDDESAQHL LMWDDDQELT PSNLEVMQTG AHSLLFMGPN DHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443851.11e-159hypothetical protein SORBIDRAFT_07g003320
TrEMBLC5YGT51e-159C5YGT5_SORBI; Putative uncharacterized protein Sb07g003320
STRINGSb07g003320.11e-159(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60323757